Recombinant Full Length Syntrophus Aciditrophicus Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL33963SF |
Product Overview : | Recombinant Full Length Syntrophus aciditrophicus Undecaprenyl-diphosphatase(uppP) Protein (Q2LXE8) (1-343aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Syntrophus aciditrophicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-343) |
Form : | Lyophilized powder |
AA Sequence : | MKKHHLRHALLVLSAAILLAVSCSFSAASASASPPASEKKIAVWEAAILGVVEGITEYLP ISSTGHLILASHALGMTQFSETRGPLGTLMVKNDAMDSYNIVIQLGAILAVLGLYRKRVK QMLKGLSGALAVLVSRRSVTALGDSERQGLKLLGLLLLAFLPAAVFGKLFHEVIETYLFG PLPVVYALVAGGVLMIGVEYFFWLKDRNRLRISDVNSMFYRQALFIGMMQVVSMWPGTSR SMITMIAGLIVGLDMIAAAEFSFLLALPTLGAATLYSGYKNWHALDDSAGMLALAVGLAV SWLTAVIAVKALVRWLTHHGLIPFGVYRILLAGVLLIYFWQWR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; SYNAS_28830; SYN_02394; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q2LXE8 |
◆ Recombinant Proteins | ||
RFL34988RF | Recombinant Full Length Rat Fun14 Domain-Containing Protein 1(Fundc1) Protein, His-Tagged | +Inquiry |
PHB2-4078R | Recombinant Rat PHB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPM1B-7594Z | Recombinant Zebrafish NPM1B | +Inquiry |
RFL26472HF | Recombinant Full Length Haemophilus Somnus Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
EPB41-3351H | Recombinant Human EPB41 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
CAPN2-350B | Native Bovine CAPN2 | +Inquiry |
FSH-35H | Native Human FSH | +Inquiry |
LDLc-01H | Native Human Low-Density Lipoprotein cholesterol | +Inquiry |
Lactate dehydrogenase-039B | Active Native Bovine Lactate dehydrogenase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYBPC1-4042HCL | Recombinant Human MYBPC1 293 Cell Lysate | +Inquiry |
CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
SMCO3-79HCL | Recombinant Human SMCO3 lysate | +Inquiry |
H1FNT-5665HCL | Recombinant Human H1FNT 293 Cell Lysate | +Inquiry |
CTSA-2399MCL | Recombinant Mouse CTSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket