Recombinant Full Length Lymnaea Stagnalis 5-Hydroxytryptamine Receptor Protein, His-Tagged
Cat.No. : | RFL21350LF |
Product Overview : | Recombinant Full Length Lymnaea stagnalis 5-hydroxytryptamine receptor Protein (Q25414) (1-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lymnaea stagnalis (Great pond snail) (Helix stagnalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-509) |
Form : | Lyophilized powder |
AA Sequence : | MANFTFGDLALDVARMGGLASTPSGLRSTGLTTPGLSPTGLVTSDFNDSYGLTGQFINGS HSSRSRDNASANDTSATNMTDDRYWSLTVYSHEHLVLTSVILGLFVLCCIIGNCFVIAAV MLERSLHNVANYLILSLAVADLMVAVLVMPLSVVSEISKVWFLHSEVCDMWISVDVLCCT ASILHLVAIAMDRYWAVTSIDYIRRRSARRILLMIMVVWIVALFISIPPLFGWRDPNNDP DKTGTCIISQDKGYTIFSTVGAFYLPMLVMMIIYIRIWLVARSRIRKDKFQMTKARLKTE ETTLVASPKTEYSVVSDCNGCNSPDSTTEKKKRRAPFKSYGCSPRPERKKNRAKKLPENA NGVNSNSSSSERLKQIQIETAEAFANGCAEEASIAMLERQCNNGKKISSNDTPYSRTREK LELKRERKAARTLAIITGAFLICWLPFFIIALIGPFVDPEGIPPFARSFVLWLGYFNSLL NPIIYTIFSPEFRSAFQKILFGKYRRGHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lymnaea stagnalis 5-hydroxytryptamine receptor |
Synonyms | 5-hydroxytryptamine receptor; 5-HT receptor; Serotonin receptor |
UniProt ID | Q25414 |
◆ Recombinant Proteins | ||
OCRL-1442H | Recombinant Human OCRL, His-tagged | +Inquiry |
RFL10004PF | Recombinant Full Length Pan Troglodytes Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
PTPRS-470H | Recombinant Human PTPRS, GST-tagged, Active | +Inquiry |
gB-109C | Recombinant CMV gB protein, hFc-tagged | +Inquiry |
CXCL8-03C | Recombinant Canine CXCL8 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
S100a6-43M | Native Mouse S100A6 | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPHP1-1210HCL | Recombinant Human NPHP1 cell lysate | +Inquiry |
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
PUS7L-1446HCL | Recombinant Human PUS7L cell lysate | +Inquiry |
ZNHIT6-223HCL | Recombinant Human ZNHIT6 cell lysate | +Inquiry |
PVRL2-1403RCL | Recombinant Rat PVRL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lymnaea stagnalis 5-hydroxytryptamine receptor Products
Required fields are marked with *
My Review for All Lymnaea stagnalis 5-hydroxytryptamine receptor Products
Required fields are marked with *
0
Inquiry Basket