Recombinant Canine CXCL8 Protein, His-tagged

• Cat.No.: CXCL8-03C
• Product Overview: Recombinant canine IL-8/CXCL8 (28-101aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Canine
• Source: HEK293
• Tag: His
• ProteinLength: 28-101 a.a.
• Description: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
• Form: Liquid
• Molecular Mass: 9.4 kDa (80aa)
• AA Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by BCA assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol

Gene Information

• Gene Name: CXCL8 C-X-C motif chemokine ligand 8 [ Canis lupus familiaris (dog) ]
• Official Symbol: CXCL8
• Synonyms: CXCL8; C-X-C motif chemokine ligand 8; IL8; interleukin-8; C-X-C motif chemokine 8; IL-8; chemokine (C-X-C motif) ligand 8
• Gene ID: 403850
• mRNA Refseq: NM_001003200
• Protein Refseq: NP_001003200
• UniProt ID: P41324