Recombinant Canine CXCL8 Protein, His-tagged

Cat.No. : CXCL8-03C
Product Overview : Recombinant canine IL-8/CXCL8 (28-101aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : HEK293
Tag : His
Protein Length : 28-101 a.a.
Description : IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Form : Liquid
Molecular Mass : 9.4 kDa (80aa)
AA Sequence : VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by BCA assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol
Gene Name CXCL8 C-X-C motif chemokine ligand 8 [ Canis lupus familiaris (dog) ]
Official Symbol CXCL8
Synonyms CXCL8; C-X-C motif chemokine ligand 8; IL8; interleukin-8; C-X-C motif chemokine 8; IL-8; chemokine (C-X-C motif) ligand 8
Gene ID 403850
mRNA Refseq NM_001003200
Protein Refseq NP_001003200
UniProt ID P41324

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL8 Products

Required fields are marked with *

My Review for All CXCL8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon