Recombinant Full Length Listeria Innocua Serovar 6A Upf0754 Membrane Protein Lin2327(Lin2327) Protein, His-Tagged
Cat.No. : | RFL33320LF |
Product Overview : | Recombinant Full Length Listeria innocua serovar 6a UPF0754 membrane protein lin2327(lin2327) Protein (Q929E9) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria innocua serovar 6a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MSVLFTILLMAVIGGFIGAMTNYIAIRMLFRPYKAVYLFNKRLPFTPGLIPKRRDELAEH IGKVVVSHLLTEDAIRARLLDENLQREVTETITKMFHEKMKLETTPNELLHHLGYENAEV RSISWLERTLEIEISRFLTTKQSTQMSELIPSMLENELTKKLPHVTERITSKMSVFIASE AGKIQIKQMLQKFFEEHGKMGSMARMFINIDSFSEKIQQEGLKLINQEDTKNIINQLLTT EWHNFEAKELQELIPTEKQAHLAGQLTSEIIQAVPHEKLFNQPIQGILRNYESAITEKMI PFAVERMLDFVATHSAEIVERMDLAKLVETQIATFSLPEIEKLVVEISGRELKMITYLGG ILGGFIGIIQGILAMWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lin2327 |
Synonyms | lin2327; UPF0754 membrane protein lin2327 |
UniProt ID | Q929E9 |
◆ Recombinant Proteins | ||
TNNI2-30135H | Recombinant Human TNNI2 protein, GST-tagged | +Inquiry |
CFC1-3293HF | Recombinant Full Length Human CFC1 Protein, GST-tagged | +Inquiry |
RFL5988YF | Recombinant Full Length Yersinia Pestis Bv. Antiqua Upf0259 Membrane Protein Ypn_1667(Ypn_1667) Protein, His-Tagged | +Inquiry |
LAMA3-301437H | Recombinant Human LAMA3 protein, GST-tagged | +Inquiry |
SORCS3-4104H | Recombinant Human SORCS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C6-101H | Native Human C6 Protein | +Inquiry |
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
LDL-405H | Native Human Low Density Lipoprotein, Acetylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFT2D2-590HCL | Recombinant Human SFT2D2 lysate | +Inquiry |
RTN4IP1-2119HCL | Recombinant Human RTN4IP1 293 Cell Lysate | +Inquiry |
SNRNP70-1620HCL | Recombinant Human SNRNP70 293 Cell Lysate | +Inquiry |
Cabbage-687P | Cabbage Lysate, Total Protein | +Inquiry |
CASP8-7831HCL | Recombinant Human CASP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lin2327 Products
Required fields are marked with *
My Review for All lin2327 Products
Required fields are marked with *
0
Inquiry Basket