Recombinant Human LAMA3 protein, GST-tagged
Cat.No. : | LAMA3-301437H |
Product Overview : | Recombinant Human LAMA3 (1972-2110 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu1972-Lys2110 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | EAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYEK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LAMA3 laminin subunit alpha 3 [ Homo sapiens (human) ] |
Official Symbol | LAMA3 |
Synonyms | E170; LOCS; BM600; LAMNA |
Gene ID | 3909 |
mRNA Refseq | NM_000227 |
Protein Refseq | NP_000218 |
MIM | 600805 |
UniProt ID | Q16787 |
◆ Recombinant Proteins | ||
LAMA3-212H | Recombinant Human LAMA3 Protein, His-tagged | +Inquiry |
LAMA3-301437H | Recombinant Human LAMA3 protein, GST-tagged | +Inquiry |
LAMA3-2946H | Recombinant Human LAMA3 protein, His-tagged | +Inquiry |
LAMA3/LAMB3/LAMC2-512H | Active Recombinant Human LAMA3 & LAMB3 & LAMC2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMA3-4828HCL | Recombinant Human LAMA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAMA3 Products
Required fields are marked with *
My Review for All LAMA3 Products
Required fields are marked with *
0
Inquiry Basket