Recombinant Full Length Ligand-Gated Ion Channel 50(Lgc-50) Protein, His-Tagged
Cat.No. : | RFL21447CF |
Product Overview : | Recombinant Full Length Ligand-gated ion channel 50(lgc-50) Protein (P41849) (1-476aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-476) |
Form : | Lyophilized powder |
AA Sequence : | MGFFFEYLEFNSRINLGKLIDTLLTDYDTHLLPEAEGVNVTIELHVQGVSGISEITGDFS LDVMYSEIWQDPRLSFKHLNVCATNITLKVSDFRKKIWTPDTCIINSKSSSIHSSPSENT FVILYENGLVWSNFRLNVKTPCSVNLKMFPFDSLSCEIVLESYSFNTDEVRLMWHDVPIT MMEKVELPDFDLIGWSTDHQRLEYPNGIWDRAKVKFTFARRYGFYLFQSYFPTSLTVISS WVGFFFDVRSVSARITLGVSSLLALTFQFGNVLRHLPRVSYIKCLDVWMIFSVIFIFCTL VELAIVCQLNRWERERQIGSKVLGHWLNQIRKTRKKESKADEGGGGGVGGLLRKRIPVLA QLKAAATDSNSGAATAMTTAIQPPNTNLNSITNSDNSKLVANNFTSIEHETYAYEKKRGF SHCFQRFVYAICPPDRDWTITSVQVDRCSMIMFPLSFLIFNVVYWSIYFMKMDRPM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgc-50 |
Synonyms | lgc-50; T20B12.9; Ligand-gated ion channel 50 |
UniProt ID | P41849 |
◆ Native Proteins | ||
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
HP-190C | Native Dog Haptoglobin | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCWPW1-1967HCL | Recombinant Human ZCWPW1 cell lysate | +Inquiry |
PHOX2B-3216HCL | Recombinant Human PHOX2B 293 Cell Lysate | +Inquiry |
EXTL3-6493HCL | Recombinant Human EXTL3 293 Cell Lysate | +Inquiry |
ZG16-171HCL | Recombinant Human ZG16 293 Cell Lysate | +Inquiry |
NLRP10-3803HCL | Recombinant Human NLRP10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lgc-50 Products
Required fields are marked with *
My Review for All lgc-50 Products
Required fields are marked with *
0
Inquiry Basket