Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 71A(Or71A) Protein, His-Tagged
Cat.No. : | RFL11023DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative odorant receptor 71a(Or71a) Protein (Q9VUK5) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MDYDRIRPVRFLTGVLKWWRLWPRKESVSTPDWTNWQAYALHVPFTFLFVLLLWLEAIKS RDIQHTADVLLICLTTTALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMWRFE HRRFNRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQPVLFWYAFIYQATT IPIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQHDDKDLREKFLELIHLHQRLKQQ ALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPT IYGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFT KTMNQAYSLLALLLNMNQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or71a |
Synonyms | Or71a; CG17871; Putative odorant receptor 71a |
UniProt ID | Q9VUK5 |
◆ Recombinant Proteins | ||
CCL3-1490H | Recombinant Human CCL3 Protein (Ala27-Ala92), N-GST tagged | +Inquiry |
TP15-162T | Recombinant Treponema Pallidum 15kD Membrane Protein, His-G-tagged | +Inquiry |
Spike-3925B | Recombinant BCoV(strain Quebec) Spike protein(314-634aa), His-tagged | +Inquiry |
C10orf119-10347H | Recombinant Human C10orf119, His-tagged | +Inquiry |
Ackr1-1495M | Recombinant Mouse Ackr1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Chitin-001C | Native Crawfish Chitin | +Inquiry |
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
LDH2-220H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
CTLGV2EB-359C | Active Native Chlamydia trachomatis LGV Type-2 EB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WSB1-281HCL | Recombinant Human WSB1 293 Cell Lysate | +Inquiry |
PRB3-2891HCL | Recombinant Human PRB3 293 Cell Lysate | +Inquiry |
BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
ACVR1C-1277CCL | Recombinant Cynomolgus ACVR1C cell lysate | +Inquiry |
RAPSN-2517HCL | Recombinant Human RAPSN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Or71a Products
Required fields are marked with *
My Review for All Or71a Products
Required fields are marked with *
0
Inquiry Basket