Recombinant Full Length Leptospira Interrogans Serogroup Icterohaemorrhagiae Serovar Lai Apolipoprotein N-Acyltransferase 1(Lnt1) Protein, His-Tagged
Cat.No. : | RFL27522LF |
Product Overview : | Recombinant Full Length Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Apolipoprotein N-acyltransferase 1(lnt1) Protein (Q8F724) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MFYNFISKDSILYRLILCFGIGIGTVFGLSPFSFFSAGVFASISCIFLFFSLNRTSIWKA FLWLLILSQILNFTAFYWIPGAISRISGVNTFVSILFFFLYGLISHLKFFLFYTLFRFSK IDSASKTYILLIFPAAGTLSDMITFQIFPWYWGNLISGSIVFEQFASICGVYGLSFLLLF ISSTFLILVNYYKYKNSKEFKTSIASLICITFIYGFGLYRIGYINQSQNELKPKNLSVLM IQPDTSPGTKDLKADASYLSATMSKVFSLAIPTFENSPSLIVIPESAIPFHGTIDSEENR KEKIYSSTMEGIILYLSKHTGADVLFNELNLDENKLRNQVSLFKNLDGKTERYNKRRLLP FGEYLPMEKNFPFLRSIFQETSRYVPGEFPKLLIGNKIQNQRSFLPPEISKLNEPKTYRY EFSSIVEHTNKIRNLEYSYSILPLLCYEAMFTELVLDYFQNEQKPEVLINITNDSWFDSE LEAYQHSGAVRLRAIETGLPLIRSAVSGISEVWDARGIPMIVPIGFHETGTRAFSIRLDA IESTIYTRFGNSFLWIFCILILISRLIFVSRIERKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt1 |
Synonyms | lnt1; LA_1124; Apolipoprotein N-acyltransferase 1; ALP N-acyltransferase 1 |
UniProt ID | Q8F724 |
◆ Native Proteins | ||
HBA2-27786TH | Native Human HBA2 | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fallopian-127C | Cynomolgus monkey Fallopian Tube Lysate | +Inquiry |
C19orf57-8200HCL | Recombinant Human C19orf57 293 Cell Lysate | +Inquiry |
VPS45-384HCL | Recombinant Human VPS45 293 Cell Lysate | +Inquiry |
IFT20-5275HCL | Recombinant Human IFT20 293 Cell Lysate | +Inquiry |
PLEKHA7-3116HCL | Recombinant Human PLEKHA7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt1 Products
Required fields are marked with *
My Review for All lnt1 Products
Required fields are marked with *
0
Inquiry Basket