Recombinant Full Length Leptospira Interrogans Serogroup Icterohaemorrhagiae Serovar Copenhageni Apolipoprotein N-Acyltransferase 1(Lnt1) Protein, His-Tagged
Cat.No. : | RFL10074LF |
Product Overview : | Recombinant Full Length Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Apolipoprotein N-acyltransferase 1(lnt1) Protein (Q72PB6) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MFYNFISKDSILYRLILCFGIGIGTVFGLSPFSFFSAGVFASISCIFLFFSLNRTSIWKA FLWLLILSQILNFTAFYWIPGAISRISGANTFVSILFFFLYGLISHLKFFLFYTLFRFSK IDSASKTYILLIFPAAGTLSDMITFQIFPWYWGNLISGSIVFEQFASICGVYGLSFLLLF ISSTFLILVNYYKYKNSKEFKTSIASLICIAFIYRFGLYRIGYINQSQNELKPKNLSVLM IQPDTSPGTKDLKADASYLSATMSKVFSLAIPTFENSPSLIVIPESAIPFHGTIDSEENR KEKIYSSTMEGIILYLSKHTGADVLFNELNLDENKLRNQVSLFKNLDGKTERYNKRRLLP FGEYLPMEKNFPFLRSIFQETSRYVPGEFPKLLIGNKIQNQRSFLPPEISKLNEPKTYRY EFSSIVEHTNKIRNLEYSYSILPLLCYEAMFTELVLDYFQNEQKPEVLINITNDSWFDSE LEAYQHSGAVRLRAIETGLPLIRSAVSGISEVWDARGIPMIVPIGFHETGTRAFSIRLDA IESTIYTRFGNSFLWIFCILILISRLIFVSRIERKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt1 |
Synonyms | lnt1; LIC_12556; Apolipoprotein N-acyltransferase 1; ALP N-acyltransferase 1 |
UniProt ID | Q72PB6 |
◆ Recombinant Proteins | ||
GNA14-5026H | Recombinant Human GNA14 Protein, GST-tagged | +Inquiry |
ZUFSP-6375R | Recombinant Rat ZUFSP Protein, His (Fc)-Avi-tagged | +Inquiry |
ACTG1-284M | Recombinant Mouse ACTG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DERL3-4652C | Recombinant Chicken DERL3 | +Inquiry |
FLNC-6142C | Recombinant Chicken FLNC | +Inquiry |
◆ Native Proteins | ||
Alb-503R | Native Rat Alb Protein | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1B & B2M-001HCL | Recombinant Human CD1B & B2M cell lysate | +Inquiry |
Fronal Lobe-24H | Human Frontal Lobe Tissue Lysate | +Inquiry |
ALKBH8-18HCL | Recombinant Human ALKBH8 lysate | +Inquiry |
RPS10-556HCL | Recombinant Human RPS10 lysate | +Inquiry |
RAB11FIP5-2137HCL | Recombinant Human RAB11FIP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lnt1 Products
Required fields are marked with *
My Review for All lnt1 Products
Required fields are marked with *
0
Inquiry Basket