Recombinant Full Length Lepidium Virginicum Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL10225LF |
Product Overview : | Recombinant Full Length Lepidium virginicum Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (A4QLA2) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lepidium virginicum (Virginia pepperweed) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHVISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICIFGGIWHILT KPFAWARRALVWSGEAYLSYSLAALSVCGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | A4QLA2 |
◆ Recombinant Proteins | ||
CCDC86-858R | Recombinant Rat CCDC86 Protein, His (Fc)-Avi-tagged | +Inquiry |
EXOSC10-26640TH | Recombinant Human EXOSC10, His-tagged | +Inquiry |
YERA-1193B | Recombinant Bacillus subtilis YERA protein, His-tagged | +Inquiry |
RFL125AF | Recombinant Full Length Aplysia Californica Synaptotagmin-1(Syt1) Protein, His-Tagged | +Inquiry |
CHRM1-685R | Recombinant Rhesus Macaque CHRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WFDC11-321HCL | Recombinant Human WFDC11 293 Cell Lysate | +Inquiry |
TGFBR3-1847MCL | Recombinant Mouse TGFBR3 cell lysate | +Inquiry |
DMPK-488HCL | Recombinant Human DMPK cell lysate | +Inquiry |
SMC1A-1666HCL | Recombinant Human SMC1A 293 Cell Lysate | +Inquiry |
FOXO3-6148HCL | Recombinant Human FOXO3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket