Recombinant Full Length Solanum Lycopersicum Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL29066SF |
Product Overview : | Recombinant Full Length Solanum lycopersicum Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q2MIA4) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSIIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRALVWSGEAYLSYSLGALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFFFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q2MIA4 |
◆ Recombinant Proteins | ||
SUB1-1857C | Recombinant Chicken SUB1 | +Inquiry |
Spike-4706V | Active Recombinant COVID-19 Spike RBD Protein (L452R, T478K), His-Avi-tagged, Biotinylated | +Inquiry |
NELL1-10581M | Recombinant Mouse NELL1 Protein | +Inquiry |
Spike-4640V | Active Recombinant COVID-19 Spike RBD Protein, His Tag (BA.2.11/Omicron), His-tagged | +Inquiry |
TPP2-9543M | Recombinant Mouse TPP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Tf-264R | Native Rat Transferrin | +Inquiry |
Fgb -68R | Native Rat Fibrinogen | +Inquiry |
ALB-54C | Native Cyno monkey Albumin | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
Collagen-48H | Native Human Collagen V | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
YPEL5-238HCL | Recombinant Human YPEL5 293 Cell Lysate | +Inquiry |
EPN1-6581HCL | Recombinant Human EPN1 293 Cell Lysate | +Inquiry |
HEXIM1-5577HCL | Recombinant Human HEXIM1 293 Cell Lysate | +Inquiry |
GBP5-5997HCL | Recombinant Human GBP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket