Recombinant Full Length Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL36590AF |
Product Overview : | Recombinant Full Length Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q70Y07) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Amborella trichopoda |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGVGAFLLVFKALYFGGVYDTWAPGGG DVRKITNLTLSPSVIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGFICILGGIWHILT KPFAWARRAFVWSGEAYLSYSLGALSIFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q70Y07 |
◆ Recombinant Proteins | ||
METTL18-6165HF | Recombinant Full Length Human METTL18 Protein, GST-tagged | +Inquiry |
Spike-1295V | Recombinant COVID-19 Spike RBD(F486S) protein(Arg319-Phe541), His-tagged | +Inquiry |
SSP-RS07910-0580S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS07910 protein, His-tagged | +Inquiry |
RFL19209XF | Recombinant Full Length Xenopus Laevis Reticulon-2(Rtn2) Protein, His-Tagged | +Inquiry |
Carm1-1966M | Recombinant Mouse Carm1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C3c-49H | Native Human Complement C3c | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
TF-31156TH | Native Human TF | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRC1-459HCL | Recombinant Human PRC1 cell lysate | +Inquiry |
FAM168B-262HCL | Recombinant Human FAM168B lysate | +Inquiry |
Duodenum-573M | MiniPig Duodenum Lysate, Total Protein | +Inquiry |
SLC26A11-1755HCL | Recombinant Human SLC26A11 293 Cell Lysate | +Inquiry |
S100A3-2090HCL | Recombinant Human S100A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket