Recombinant Full Length Lachancea Thermotolerans Probable Metalloreductase Aim14(Aim14) Protein, His-Tagged
Cat.No. : | RFL30774LF |
Product Overview : | Recombinant Full Length Lachancea thermotolerans Probable metalloreductase AIM14(AIM14) Protein (C5E398) (1-533aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea thermotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-533) |
Form : | Lyophilized powder |
AA Sequence : | MAMTLLPRHGKTHLANIPYGYYTATVSLIFIILLIGARKLIPVRQRNRSKWAKWALSSAR GGSPLLYLVVLFVALLVPFVHHYSLLGYVGLYLKRLGRLSYVLATLNLFLTLRPNFLLPG YVYLDLIPLHKWLSRSLCLLALVHGVGFLVKWALDSQVSFVAKAFYNIPNLAGLVVGALM AFMVLLSVRPVRRFSYRSFYLTHIIGAWVFVFLTAYHARPGVFVPYTLLNAGLFVFYILS KTVPARGVELVSKSTDDVNNCLTRIVLPRKAMPEHFAPGSHLRISPYRRVNPLYYMLPSH PYTVASMPEDKDVELIVREHASGFHLLTGLGYTIQNHYESVPRQCLQSATRIALVCGGSG LSYALPIFRHFASEEKADQVKYLRLIWLVRDKYDVNVLGNIRSLASSVAQFDIFVTRSVP PDDTVESGSKLSPAQQQSPITDDLEFELESFGDQLDQNGALITPEIPNLPSGLASSFHFG RKLDWMTDLAQFVEREDLGSTWLVACGPKGLNDAAKLYAQQNEINLASETYAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIM14 |
Synonyms | AIM14; KLTH0H11550g; Probable metalloreductase AIM14 |
UniProt ID | C5E398 |
◆ Recombinant Proteins | ||
RFC3-3857R | Recombinant Rhesus monkey RFC3 Protein, His-tagged | +Inquiry |
CAMK2N1A-7303Z | Recombinant Zebrafish CAMK2N1A | +Inquiry |
UBA52-06H | Synthetic Human Di-ubiquitin (K29-linked) Protein | +Inquiry |
CBLN3-2735M | Recombinant Mouse CBLN3 Protein (25-197 aa), His-tagged | +Inquiry |
Igf2-818R | Recombinant Rat Igf2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA6-804H | Native Human CA6 | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
AGT-152H | Native Human Angiotensinogen | +Inquiry |
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TM4SF18-668HCL | Recombinant Human TM4SF18 lysate | +Inquiry |
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
SZT2-905HCL | Recombinant Human SZT2 cell lysate | +Inquiry |
ZNF92-2093HCL | Recombinant Human ZNF92 cell lysate | +Inquiry |
SRP9-1476HCL | Recombinant Human SRP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIM14 Products
Required fields are marked with *
My Review for All AIM14 Products
Required fields are marked with *
0
Inquiry Basket