Recombinant Full Length Saccharomyces Cerevisiae Probable Metalloreductase Aim14(Aim14) Protein, His-Tagged
Cat.No. : | RFL2698SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Probable metalloreductase AIM14(AIM14) Protein (A6ZU25) (1-570aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-570) |
Form : | Lyophilized powder |
AA Sequence : | MKESPLITLVKRHSETHFANIKYGYYVLIISLVYLIGLALLRAFGRRTPSRSSSAFKNKI IYRLYDIDPAIHLGILFFAVLIPFYYHYSLTTQSTVYLKRLGRLSYALIPLNLFLTLRPN WFLRKNCTYTDFIPFHKWFSRIITVIGLLHGIFFIIKWAIDDNVSLKQKLILKTFNFVGF IISILVLFLLICSIGPMRRYNYRLFYIVHNLVNVAFILLTPIHSRPGVKFPFLLLNCTLL FIHIINRIVFAKSLMILNKNANYSKTNLVHVRLPRAILPDYFEPGSHIRISPYRRINPLY WLLPSHPYTIASLAEDNSIDLIIKETSTAEPGSQIESLRSNPKSFHLDQEKTYTLINSYP PSVPEECYSQGTNIAIICGGSGISFALPLFRHFFNKENVKYLKMIWLIKNYSEYELVLDY LKTNGLTFEKKLSNNKRISVFISGEYTAETRLDEITTNIDDENSEYEMGSFNNEDEDLSI SNFNSENADSNDNTPETSHSPTKENGSLIEVKSKHSFTLSNELKSFNNESAQVNQNETWL FSCGPPSLLQLSKKYCNDERINFVCETYGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIM14 |
Synonyms | AIM14; SCY_1908; Probable metalloreductase AIM14; Altered inheritance of mitochondria protein 14 |
UniProt ID | A6ZU25 |
◆ Recombinant Proteins | ||
ACSS1-2163H | Recombinant Human ACSS1 Protein (38-689 aa), His-tagged | +Inquiry |
PDAP1-3337R | Recombinant Rhesus monkey PDAP1 Protein, His-tagged | +Inquiry |
PPM1D-2917H | Recombinant Human PPM1D protein, His-tagged | +Inquiry |
MNX1-6289HF | Recombinant Full Length Human MNX1 Protein, GST-tagged | +Inquiry |
RFL35420MF | Recombinant Full Length Mouse Transmembrane Protein 45A(Tmem45A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSC-422HCL | Recombinant Human MSC lysate | +Inquiry |
COL5A2-908HCL | Recombinant Human COL5A2 cell lysate | +Inquiry |
ARC-106HCL | Recombinant Human ARC cell lysate | +Inquiry |
SFXN4-1892HCL | Recombinant Human SFXN4 293 Cell Lysate | +Inquiry |
ZFYVE27-173HCL | Recombinant Human ZFYVE27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIM14 Products
Required fields are marked with *
My Review for All AIM14 Products
Required fields are marked with *
0
Inquiry Basket