Recombinant Full Length Clavispora Lusitaniae Probable Metalloreductase Aim14(Aim14) Protein, His-Tagged
Cat.No. : | RFL108CF |
Product Overview : | Recombinant Full Length Clavispora lusitaniae Probable metalloreductase AIM14(AIM14) Protein (C4Y9R6) (1-513aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clavispora lusitaniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-513) |
Form : | Lyophilized powder |
AA Sequence : | MTTSKIGVRHAGHGHTVNIKYGYIIFGVSVLYALLLASAHFLELRQWRRQKRPSRSSVWA RINNAPFWVHTLLWAAIVVGLAFTNVHDLSQNWTVVVKRLGRLAFCLVPLDLALALRPCL LGQSYLELMPLHKWLSRLIILAGVVHGIGFFVKWTIHHQLGKAKRWANLAGIIVALFSVL LVIVSSRPVRRRFYSYFYAFHNFTVALFVLLMIWHARPGVSDFVLLSVALLLFQGASRVY NGYSVPGLTIVDADAASLRLLRLQKPNSFPSVWQPGSHIRVGLPLSSWQSWVFPAHLYTL CSSPANDTLNLVVKKGRRFEMLTSLEYRVSCPYASLPTPWLSTAENVHIVCGGSGISLGI PLYEYFDNKSSVLANLHWCVSNARDTFVLSELGVNNPVNVYVTSGKIDQSSYDDADNEDA GLLGAGDNIELEPIPAENKSNPFTDDHAVNCAEQRIQMHAGRPNLSEILASFSETDDNAH KLLIVCGPVGLIRDVRAYGDAHGIAVFSELYNM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AIM14 |
Synonyms | AIM14; CLUG_05137; Probable metalloreductase AIM14 |
UniProt ID | C4Y9R6 |
◆ Recombinant Proteins | ||
PGAM1-3199C | Recombinant Chicken PGAM1 | +Inquiry |
Il12a-6736M | Recombinant Mouse Il12a Protein (Met1-Ala215, Met1-Ser335), C-His and C-TwinStrep tagged | +Inquiry |
HS1BP3-8133Z | Recombinant Zebrafish HS1BP3 | +Inquiry |
RFL24921SF | Recombinant Full Length Na(+)/H(+) Antiporter Subunit E1 Protein, His-Tagged | +Inquiry |
FUT11-2069R | Recombinant Rat FUT11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
ppk-8320P | Native Propionibacterium shermanii ppk | +Inquiry |
Alb-113R | Native Rat Serum Albumin | +Inquiry |
F2-5401B | Native Bovine Coagulation Factor II (thrombin) | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF4-8630HCL | Recombinant Human ATF4 293 Cell Lysate | +Inquiry |
CDKN2D-7611HCL | Recombinant Human CDKN2D 293 Cell Lysate | +Inquiry |
FETUB-2022HCL | Recombinant Human FETUB cell lysate | +Inquiry |
ZNF582-42HCL | Recombinant Human ZNF582 293 Cell Lysate | +Inquiry |
MRPS26-4140HCL | Recombinant Human MRPS26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIM14 Products
Required fields are marked with *
My Review for All AIM14 Products
Required fields are marked with *
0
Inquiry Basket