Recombinant Full Length Lachancea Thermotolerans Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL29651LF |
Product Overview : | Recombinant Full Length Lachancea thermotolerans Autophagy-related protein 32(ATG32) Protein (C5DH39) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea thermotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHLSVLQLLDRADPPSEL SSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQGDATHQHAGILSSSDT SEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTM SLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREM NKYSAVMVIFGEPKEGKELLEKVAAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYH LTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVNRWVIWS ISLTVGVGLGYCISCLLSSTSSTLSVTLRSGDEVTIMEDIHNSPHESPFDNYLRHLLLAV KRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; KLTH0E01122g; Autophagy-related protein 32 |
UniProt ID | C5DH39 |
◆ Recombinant Proteins | ||
BLVRA-2508H | Recombinant Human Biliverdin Reductase A | +Inquiry |
PPP3R1-5969H | Recombinant Human PPP3R1 Protein (Gly2-Val170), N-GST tagged | +Inquiry |
PRLR-4144H | Active Recombinant Human Prolactin Receptor | +Inquiry |
GIF-3552M | Recombinant Mouse GIF Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL15929VF | Recombinant Full Length Vibrio Harveyi Atp Synthase Subunit A 1(Atpb1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
C4A-158H | Native Human C4A protein | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
PLG-30880TH | Native Human PLG | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH2-4472HCL | Recombinant Human MARCH2 293 Cell Lysate | +Inquiry |
STBD1-694HCL | Recombinant Human STBD1 cell lysate | +Inquiry |
PNCK-1384HCL | Recombinant Human PNCK cell lysate | +Inquiry |
SNX25-1662HCL | Recombinant Human SNX25 cell lysate | +Inquiry |
HL-60-045HCL | Human HL-60 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket