Recombinant Full Length Kluyveromyces Lactis Spore Membrane Assembly Protein 2(Sma2) Protein, His-Tagged
Cat.No. : | RFL20097KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Spore membrane assembly protein 2(SMA2) Protein (Q6CWD4) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MRFKYISFIILISFSLLVWFSHLSNFTCTSSANLPICMPQYVFHFKDDTPTSKVLFSTVK EFFSLLSFFTLDFNWGIDLSELQDRYNQSNLINIFHPSNTYYVNAFGYCKHQAQDEKLNH YCIDNTNGLNIISVLIRDLGFQFGVLSETNVKITGDSFWIIYQTLINSFNKFLEDDKRGN TLLKMITPNDPNEMEQWKTRLWLINIYDAVNVVLKWTVVANCILASLCLMLLLFWMWMQI EHKKTQSPIKQLNWNINSICSITRCLSICNATITFIYILHILLLTFMINCFRYKRLQIIH ASLGTGAWFHIARFFVELIFAVLCFKWMTPHSAMSASVMSETQSTAVEDEEEKDTEDNYS ALNPASGTTAVDGFLLTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMA2 |
Synonyms | SMA2; KLLA0B04972g; Spore membrane assembly protein 2 |
UniProt ID | Q6CWD4 |
◆ Recombinant Proteins | ||
FAM26E-3531C | Recombinant Chicken FAM26E | +Inquiry |
RFL23103EF | Recombinant Full Length Escherichia Coli O157:H7 Cobalamin Synthase(Cobs) Protein, His-Tagged | +Inquiry |
RAB38-1834H | Recombinant Human RAB38 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT11-4470Z | Recombinant Zebrafish GALNT11 | +Inquiry |
GPX3-5310H | Recombinant Human GPX3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
UO-44 | Active Native Urate oxidase | +Inquiry |
Lectin-1857V | Active Native Vicia Villosa Lectin Protein, Fluorescein labeled | +Inquiry |
Hemocyanin-30S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free | +Inquiry |
TF-31158TH | Native Human TF | +Inquiry |
TFRC-249H | Native Human Transferrin Receptor | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNRD3IT1-616HCL | Recombinant Human TXNRD3IT1 293 Cell Lysate | +Inquiry |
DAPL1-7075HCL | Recombinant Human DAPL1 293 Cell Lysate | +Inquiry |
PDE10A-3355HCL | Recombinant Human PDE10A 293 Cell Lysate | +Inquiry |
RIC3-2341HCL | Recombinant Human RIC3 293 Cell Lysate | +Inquiry |
DDR1-401MCL | Recombinant Mouse DDR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMA2 Products
Required fields are marked with *
My Review for All SMA2 Products
Required fields are marked with *
0
Inquiry Basket