Recombinant Human GPX3 Protein, His-tagged

• Cat.No.: GPX3-5310H
• Product Overview: Human GPX3 (NP_002075, 21 a.a. - 226 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-226 a.a.
• Description: This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3 UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 25.7 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYCGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK
• Purity: > 85% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 (40% glycerol, 1 mM DTT)

Gene Information

• Gene Name: GPX3 glutathione peroxidase 3 (plasma) [ Homo sapiens ]
• Official Symbol: GPX3
• Synonyms: GPX3; glutathione peroxidase 3 (plasma); glutathione peroxidase 3; GPx-3; plasma glutathione peroxidase; extracellular glutathione peroxidase; GPx-P; GSHPx-3; GSHPx-P
• Gene ID: 2878
• mRNA Refseq: NM_002084
• Protein Refseq: NP_002075
• MIM: 138321
• UniProt ID: P22352