Recombinant Full Length Innexin-19(Inx-19) Protein, His-Tagged
Cat.No. : | RFL22475CF |
Product Overview : | Recombinant Full Length Innexin-19(inx-19) Protein (A8WVX4) (1-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis briggsae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-439) |
Form : | Lyophilized powder |
AA Sequence : | MFFHATLARSFISALSVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREEKQIGYYQWVPFILIAEALMFSLPC IFWRLCSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRAR GWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLKSSEFVFFGFQVLSDIW AGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIIT TCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLD SFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFEEHEEMKDVEMRRI QGTRERIVIANPGQTKSFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inx-19 |
Synonyms | inx-19; CBG03987; Innexin-19 |
UniProt ID | A8WVX4 |
◆ Recombinant Proteins | ||
TGFBR1-1495H | Active Recombinant Human TGFBR1, GST-tagged | +Inquiry |
MSI2-5654H | Recombinant Human MSI2 Protein, GST-tagged | +Inquiry |
GTF2H4-7361M | Recombinant Mouse GTF2H4 Protein | +Inquiry |
KCTD15B-964Z | Recombinant Zebrafish KCTD15B | +Inquiry |
RFL23571MF | Recombinant Full Length Mouse Vomeronasal Type-1 Receptor 41(Vmn1R41) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
NEFH-181B | Native Bovine NEFH Protein | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
ACP-150P | Active Native Potato Acid Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEXB-756HCL | Recombinant Human HEXB cell lysate | +Inquiry |
RBX1-2450HCL | Recombinant Human RBX1 293 Cell Lysate | +Inquiry |
PTK2B-2698HCL | Recombinant Human PTK2B 293 Cell Lysate | +Inquiry |
MS4A2-4126HCL | Recombinant Human MS4A2 293 Cell Lysate | +Inquiry |
KCNMB3-5025HCL | Recombinant Human KCNMB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All inx-19 Products
Required fields are marked with *
My Review for All inx-19 Products
Required fields are marked with *
0
Inquiry Basket