Recombinant Full Length Inner Membrane Transport Permease Ybhs(Ybhs) Protein, His-Tagged
Cat.No. : | RFL2339EF |
Product Overview : | Recombinant Full Length Inner membrane transport permease ybhS(ybhS) Protein (P0AFQ4) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MSNPILSWRRVRALCVKETRQIVRDPSSWLIAVVIPLLLLFIFGYGINLDSSKLRVGILL EQRSEAALDFTHTMTGSPYIDATISDNRQELIAKMQAGKIRGLVVIPVDFAEQMERANAT APIQVITDGSEPNTANFVQGYVEGIWQIWQMQRAEDNGQTFEPLIDVQTRYWFNPAAISQ HFIIPGAVTIIMTVIGAILTSLVVAREWERGTMEALLSTEITRTELLLCKLIPYYFLGML AMLLCMLVSVFILGVPYRGSLLILFFISSLFLLSTLGMGLLISTITRNQFNAAQVALNAA FLPSIMLSGFIFQIDSMPAVIRAVTYIIPARYFVSTLQSLFLAGNIPVVLVVNVLFLIAS AVMFIGLTWLKTKRRLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybhS |
Synonyms | ybhS; Z1013; ECs0871; Probable multidrug ABC transporter permease YbhS |
UniProt ID | P0AFQ4 |
◆ Recombinant Proteins | ||
CTSK-6530C | Recombinant Chicken CTSK | +Inquiry |
TGM6-3316H | Recombinant Human TGM6 protein, His-tagged | +Inquiry |
FH-205H | Recombinant Human FH protein, T7/His-tagged | +Inquiry |
KAT14-4343H | Recombinant Human KAT14 protein, His-tagged | +Inquiry |
GDF3-271H | Recombinant Human GDF3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
Apotransferrin-38R | Native Rat Apotransferrin | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
CA 72-4-379H | Active Native Human Cancer Antigen 72-4 | +Inquiry |
Complement C1-42H | Native Human Complement C1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMK2A-7880HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
ALPL-3092HCL | Recombinant Human ALPL cell lysate | +Inquiry |
CXCL14-7169HCL | Recombinant Human CXCL14 293 Cell Lysate | +Inquiry |
RTN2-2123HCL | Recombinant Human RTN2 293 Cell Lysate | +Inquiry |
TMEM208-967HCL | Recombinant Human TMEM208 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ybhS Products
Required fields are marked with *
My Review for All ybhS Products
Required fields are marked with *
0
Inquiry Basket