Recombinant Full Length Influenza B Virus Glycoprotein Nb(Nb) Protein, His-Tagged
Cat.No. : | RFL3916IF |
Product Overview : | Recombinant Full Length Influenza B virus Glycoprotein NB(NB) Protein (P16200) (1-99aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Influenza B virus (strain B/Memphis/3/1989) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-99) |
Form : | Lyophilized powder |
AA Sequence : | MNNATFNYTNVNPISHIRGSVIITICVSFIVILTVFGYIAKIFIKNNCTNNDIGLRERIK CSGCEPFCNKRDDISSPRTGVDIPSFILPGLNLSESTPN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NB |
Synonyms | NB; Glycoprotein NB |
UniProt ID | P16200 |
◆ Recombinant Proteins | ||
GM757-6937M | Recombinant Mouse GM757 Protein | +Inquiry |
SPINT2-3247H | Recombinant Human SPINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLA-C-269H | Recombinant Human HLA-C protein, His-tagged | +Inquiry |
EFHC2-3298C | Recombinant Chicken EFHC2 | +Inquiry |
LILRB4-582H | Recombinant Human LILRB4, His-tagged | +Inquiry |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
F10-267B | Active Native Bovine Factor X | +Inquiry |
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
APCS-1269HCL | Recombinant Human APCS cell lysate | +Inquiry |
BST2-1242HCL | Recombinant Human BST2 cell lysate | +Inquiry |
SNX20-1640HCL | Recombinant Human SNX20 cell lysate | +Inquiry |
TMEM190-976HCL | Recombinant Human TMEM190 293 Cell Lysate | +Inquiry |
CHCHD7-7542HCL | Recombinant Human CHCHD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NB Products
Required fields are marked with *
My Review for All NB Products
Required fields are marked with *
0
Inquiry Basket