Recombinant Full Length Hyaluronan Synthase(Hasa) Protein, His-Tagged
Cat.No. : | RFL13144SF |
Product Overview : | Recombinant Full Length Hyaluronan synthase(hasA) Protein (Q8NKX1) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pyogenes serotype M18 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MPIFKKTLIVLSFIFLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGK PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hasA |
Synonyms | hasA; spyM18_2236; Hyaluronan synthase; Hyaluronate synthase; Hyaluronic acid synthase; HA synthase |
UniProt ID | Q8NKX1 |
◆ Recombinant Proteins | ||
ZHX3-9847Z | Recombinant Zebrafish ZHX3 | +Inquiry |
TACO1-4160H | Recombinant Human TACO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP5PD-6016H | Recombinant Human ATP5PD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PUS10-4315C | Recombinant Chicken PUS10 | +Inquiry |
TNFRSF9-191C | Active Recombinant Cynomolgus TNFRSF9 protein, hFc-tagged | +Inquiry |
◆ Native Proteins | ||
Chitin-001C | Native Crawfish Chitin | +Inquiry |
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A41-601HCL | Recombinant Human SLC25A41 lysate | +Inquiry |
KLHL25-4909HCL | Recombinant Human KLHL25 293 Cell Lysate | +Inquiry |
ZMYND19-148HCL | Recombinant Human ZMYND19 293 Cell Lysate | +Inquiry |
UBE2Z-1873HCL | Recombinant Human UBE2Z cell lysate | +Inquiry |
TES-662HCL | Recombinant Human TES lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hasA Products
Required fields are marked with *
My Review for All hasA Products
Required fields are marked with *
0
Inquiry Basket