Recombinant Full Length Hyaluronan Synthase(Hasa) Protein, His-Tagged
Cat.No. : | RFL33908SF |
Product Overview : | Recombinant Full Length Hyaluronan synthase(hasA) Protein (Q5X9A9) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pyogenes serotype M6 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MPIFKKTLIVLSFIFLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGN PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hasA |
Synonyms | hasA; M6_Spy1869; Hyaluronan synthase; Hyaluronate synthase; Hyaluronic acid synthase; HA synthase |
UniProt ID | Q5X9A9 |
◆ Recombinant Proteins | ||
FBXO42-3168M | Recombinant Mouse FBXO42 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gif-7878M | Recombinant Mouse Gif protein, His & T7-tagged | +Inquiry |
Ccdc107-1984M | Recombinant Mouse Ccdc107 Protein, Myc/DDK-tagged | +Inquiry |
HECTD3-3461HF | Recombinant Full Length Human HECTD3 Protein, GST-tagged | +Inquiry |
SPP1-122H | Active Recombinant Human Secreted Phosphoprotein 1, HIgG1 Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
◆ Cell & Tissue Lysates | ||
OCEL1-3607HCL | Recombinant Human OCEL1 293 Cell Lysate | +Inquiry |
TRIM3-784HCL | Recombinant Human TRIM3 293 Cell Lysate | +Inquiry |
RCN3-1282HCL | Recombinant Human RCN3 cell lysate | +Inquiry |
Eye-488C | Chicken Eye Lysate, Total Protein | +Inquiry |
NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hasA Products
Required fields are marked with *
My Review for All hasA Products
Required fields are marked with *
0
Inquiry Basket