Recombinant Full Length Hyaluronan Synthase(Hasa) Protein, His-Tagged
Cat.No. : | RFL31781SF |
Product Overview : | Recombinant Full Length Hyaluronan synthase(hasA) Protein (P0DB60) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus pyogenes serotype M3 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MPIFKKTLIVLSFICLISILIYLNMYLFGTSTVGIYGVILITYLVIKLGLSFLYEPFKGN PHDYKVAAVIPSYNEDAESLLETLKSVLAQTYPLSEIYIVDDGSSNTDAIQLIEEYVNRE VDICRNVIVHRSLVNKGKRHAQAWAFERSDADVFLTVDSDTYIYPNALEELLKSFNDETV YAATGHLNARNRQTNLLTRLTDIRYDNAFGVERAAQSLTGNILVCSGPLSIYRREVIIPN LERYKNQTFLGLPVSIGDDRCLTNYAIDLGRTVYQSTARCDTDVPFQLKSYLKQQNRWNK SFFRESIISVKKILSNPIVALWTIFEVVMFMMLIVAIGNLLFNQAIQLDLIKLFAFLSII FIVALCRNVHYMVKHPASFLLSPLYGILHLFVLQPLKLYSLCTIKNTEWGTRKKVTIFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hasA |
Synonyms | hasA; SpyM3_1851; Hyaluronan synthase; Hyaluronate synthase; Hyaluronic acid synthase; HA synthase |
UniProt ID | P0DB60 |
◆ Recombinant Proteins | ||
DDO-1324H | Recombinant Human DDO Protein, His-tagged | +Inquiry |
GNL1-2265R | Recombinant Rat GNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RMDN2-4642HF | Recombinant Full Length Human RMDN2 Protein, GST-tagged | +Inquiry |
RFL24201SF | Recombinant Full Length Suid Herpesvirus 1 Envelope Glycoprotein H(Gh) Protein, His-Tagged | +Inquiry |
CPLX3-1929M | Recombinant Mouse CPLX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GC-29857TH | Native Human GC | +Inquiry |
DAO1-25P | Active Native Porcine D-Amino acid oxidase | +Inquiry |
TF-143C | Native Chicken Serum Transferrin | +Inquiry |
RB5200-3281H | Native Human RB5200 | +Inquiry |
TcdB-189C | Active Native Clostridium difficile Toxin B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR77-5778HCL | Recombinant Human GPR77 293 Cell Lysate | +Inquiry |
OTUD6B-3514HCL | Recombinant Human OTUD6B 293 Cell Lysate | +Inquiry |
OLFM4-2429HCL | Recombinant Human OLFM4 cell lysate | +Inquiry |
NUP43-3630HCL | Recombinant Human NUP43 293 Cell Lysate | +Inquiry |
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hasA Products
Required fields are marked with *
My Review for All hasA Products
Required fields are marked with *
0
Inquiry Basket