Recombinant Full Length Human XRCC1 Protein, C-Flag-tagged
Cat.No. : | XRCC1-778HFL |
Product Overview : | Recombinant Full Length Human XRCC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is involved in the efficient repair of DNA single-strand breaks formed by exposure to ionizing radiation and alkylating agents. This protein interacts with DNA ligase III, polymerase beta and poly (ADP-ribose) polymerase to participate in the base excision repair pathway. It may play a role in DNA processing during meiogenesis and recombination in germ cells. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.3 kDa |
AA Sequence : | MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEV LVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDS PFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPS YAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTR TPATAPVPARAQGAVTGKPRGEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYR PDWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSQRYLMAGPGSSSEEDEASHSGG SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDNGAEDSGDTED ELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERR KLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVV PQATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Base excision repair |
Full Length : | Full L. |
Gene Name | XRCC1 X-ray repair cross complementing 1 [ Homo sapiens (human) ] |
Official Symbol | XRCC1 |
Synonyms | RCC; SCAR26 |
Gene ID | 7515 |
mRNA Refseq | NM_006297.3 |
Protein Refseq | NP_006288.2 |
MIM | 194360 |
UniProt ID | P18887 |
◆ Recombinant Proteins | ||
XRCC1-1500H | Recombinant Human XRCC1 Protein, MYC/DDK-tagged | +Inquiry |
XRCC1-2369H | Recombinant Human XRCC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
XRCC1-778HFL | Recombinant Full Length Human XRCC1 Protein, C-Flag-tagged | +Inquiry |
XRCC1-6578H | Recombinant Human XRCC1 Protein (Thr284-Ala633), N-His tagged | +Inquiry |
XRCC1-3756H | Recombinant Human XRCC1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XRCC1-258HCL | Recombinant Human XRCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All XRCC1 Products
Required fields are marked with *
My Review for All XRCC1 Products
Required fields are marked with *
0
Inquiry Basket