Recombinant Full Length Human VIL1 Protein, C-Flag-tagged
Cat.No. : | VIL1-278HFL |
Product Overview : | Recombinant Full Length Human VIL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 92.5 kDa |
AA Sequence : | MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDS SLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLL HVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGV VDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLL SHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWT ASNRTSGLGKTHTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMS IFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGK GCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTGR FLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ GHEPPTFTGWFLAWDPFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLE QLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | VIL1 villin 1 [ Homo sapiens (human) ] |
Official Symbol | VIL1 |
Synonyms | VIL; D2S1471 |
Gene ID | 7429 |
mRNA Refseq | NM_007127.3 |
Protein Refseq | NP_009058.2 |
MIM | 193040 |
UniProt ID | P09327 |
◆ Recombinant Proteins | ||
HIF1A-2240H | Recombinant Human HIF1A Protein, His-tagged | +Inquiry |
MCL1-4517H | Recombinant Human MCL1 Protein (Arg6-Ile328), His tagged | +Inquiry |
RFL12444HF | Recombinant Full Length Human Steap Family Member 1B(Steap1B) Protein, His-Tagged | +Inquiry |
TMEM22-9362M | Recombinant Mouse TMEM22 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPA1-3176H | Active Recombinant Human CPA1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1779G | Active Native Griffonia Simplicifolia Lectin I Protein, Biotinylated | +Inquiry |
CPB2-8517H | Active Native Human CPB2 | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
Neuraminidase-011C | Active Native Clostridium perfringens Choloylglycine Hydrolase | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDI2-5964HCL | Recombinant Human GDI2 293 Cell Lysate | +Inquiry |
ARHGAP5-8737HCL | Recombinant Human ARHGAP5 293 Cell Lysate | +Inquiry |
R3HDM4-8214HCL | Recombinant Human C19orf22 293 Cell Lysate | +Inquiry |
NEDD4L-3885HCL | Recombinant Human NEDD4L 293 Cell Lysate | +Inquiry |
Testis-499C | Chicken Testis Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VIL1 Products
Required fields are marked with *
My Review for All VIL1 Products
Required fields are marked with *
0
Inquiry Basket