Recombinant Full Length Human Uncharacterized Protein C17Orf74(C17Orf74) Protein, His-Tagged
Cat.No. : | RFL28836HF |
Product Overview : | Recombinant Full Length Human Uncharacterized protein C17orf74(C17orf74) Protein (Q0P670) (1-501aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-501) |
Form : | Lyophilized powder |
AA Sequence : | MENQLWHNTVRCCNQYQESPHDAEDILLLLLGLIVLVNIGINVATMMWHGLQNALDKMID WATQKNEIQASESPPSGPPDKAQDVHIHCILDPVQVKMSRPTQYSSFSCHHFSNHHSSSL LRCVRRRRRRHRRCRRRCCNHQQRPQNYRQIPHSHSVFRNPHRSQKMSQLHRVPFFDQED PDSYLEEEDNLPFPYPKYPRRGWGGFYQRAGLPSNVGLWGHQGGILASLPPPSLYLSPEL RCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPY PSVGWMLYDSWDQRRRGTEGFERPPASVSRNARPEAQGCREHHSPQSHQQSLLGHAYGQS HRSPHPSTEPLGYSSQDPREVRRRAADWAEALPAWRPLTTSASLTVLDEASHQRTPAPSS VLVPHSSQPWPKVQAADPAPPPTMFVPLSRNPGGNANYQVYDSLELKRQVQKSRARSSSL PPASTSTLRPSLHRSQTEKLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPEM2 |
Synonyms | SPEM2; C17orf74; Uncharacterized protein SPEM2 |
UniProt ID | Q0P670 |
◆ Recombinant Proteins | ||
IKZF3-6383C | Recombinant Chicken IKZF3 | +Inquiry |
RFL15195FF | Recombinant Full Length Cat Rhodopsin(Rho) Protein, His-Tagged | +Inquiry |
ZXDB-10512M | Recombinant Mouse ZXDB Protein, His (Fc)-Avi-tagged | +Inquiry |
Ascl2-3065M | Recombinant Mouse Ascl2, His-tagged | +Inquiry |
RFL5497MF | Recombinant Full Length Mouse Bombesin Receptor Subtype-3(Brs3) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGPAT1-36HCL | Recombinant Human AGPAT1 cell lysate | +Inquiry |
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
PVALB-2658HCL | Recombinant Human PVALB 293 Cell Lysate | +Inquiry |
RENBP-537HCL | Recombinant Human RENBP lysate | +Inquiry |
C2orf27B-8085HCL | Recombinant Human C2orf27B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPEM2 Products
Required fields are marked with *
My Review for All SPEM2 Products
Required fields are marked with *
0
Inquiry Basket