Recombinant Full Length Human TXN Protein, C-Flag-tagged

• Cat.No.: TXN-793HFL
• Product Overview: Recombinant Full Length Human TXN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 11.6 kDa
• AA Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE
  VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: TXN thioredoxin [ Homo sapiens (human) ]
• Official Symbol: TXN
• Synonyms: TRX; TRDX; TRX1; Trx80
• Gene ID: 7295
• mRNA Refseq: NM_003329.4
• Protein Refseq: NP_003320.2
• MIM: 187700
• UniProt ID: P10599