Recombinant Full Length Human TUBG1 Protein, C-Flag-tagged
Cat.No. : | TUBG1-471HFL |
Product Overview : | Recombinant Full Length Human TUBG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51 kDa |
AA Sequence : | MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDE MDTSREIVQQLIDEYHAATRPDYISWGTQEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TUBG1 tubulin gamma 1 [ Homo sapiens (human) ] |
Official Symbol | TUBG1 |
Synonyms | TUBG; GCP-1; CDCBM4; TUBGCP1 |
Gene ID | 7283 |
mRNA Refseq | NM_001070.5 |
Protein Refseq | NP_001061.2 |
MIM | 191135 |
UniProt ID | P23258 |
◆ Recombinant Proteins | ||
TUBG1-471HFL | Recombinant Full Length Human TUBG1 Protein, C-Flag-tagged | +Inquiry |
TUBG1-6520H | Recombinant Human TUBG1 Protein (Met1-Gln451), C-His tagged | +Inquiry |
TUBG1-4743H | Recombinant Human Tubulin, Gamma 1, His-tagged | +Inquiry |
TUBG1-31632TH | Recombinant Human TUBG1 | +Inquiry |
TUBG1-11150Z | Recombinant Zebrafish TUBG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBG1-644HCL | Recombinant Human TUBG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBG1 Products
Required fields are marked with *
My Review for All TUBG1 Products
Required fields are marked with *
0
Inquiry Basket