Recombinant Full Length Human TUBB4A Protein, C-Flag-tagged
Cat.No. : | TUBB4A-1213HFL |
Product Overview : | Recombinant Full Length Human TUBB4A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the beta tubulin family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene cause hypomyelinating leukodystrophy-6 and autosomal dominant torsion dystonia-4. Alternate splicing results in multiple transcript variants encoding different isoforms. A pseudogene of this gene is found on chromosome X. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.4 kDa |
AA Sequence : | MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEP GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLG GGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVK TAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS EYQQYQDATAEEGEFEEEAEEEVATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Gap junction, Pathogenic Escherichia coli infection |
Full Length : | Full L. |
Gene Name | TUBB4A tubulin beta 4A class IVa [ Homo sapiens (human) ] |
Official Symbol | TUBB4A |
Synonyms | DYT4; TUBB4; beta-5 |
Gene ID | 10382 |
mRNA Refseq | NM_006087.4 |
Protein Refseq | NP_006078.2 |
MIM | 602662 |
UniProt ID | P04350 |
◆ Recombinant Proteins | ||
Tubb4a-6729M | Recombinant Mouse Tubb4a Protein, Myc/DDK-tagged | +Inquiry |
TUBB4A-1213HFL | Recombinant Full Length Human TUBB4A Protein, C-Flag-tagged | +Inquiry |
TUBB4A-564H | Recombinant Human TUBB4A Protein, His-tagged | +Inquiry |
TUBB4A-1906H | Recombinant Human TUBB4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TUBB4A-1942H | Recombinant Human TUBB4A Protein (1-444 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB4A-647HCL | Recombinant Human TUBB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBB4A Products
Required fields are marked with *
My Review for All TUBB4A Products
Required fields are marked with *
0
Inquiry Basket