Recombinant Full Length Human TSC22D3 Protein, C-Flag-tagged

• Cat.No.: TSC22D3-889HFL
• Product Overview: Recombinant Full Length Human TSC22D3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14.6 kDa
• AA Sequence: MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transcription Factors
• Full Length: Full L.

Gene Information

• Gene Name: TSC22D3 TSC22 domain family member 3 [ Homo sapiens (human) ]
• Official Symbol: TSC22D3
• Synonyms: DIP; GILZ; DSIPI; TSC-22R
• Gene ID: 1831
• mRNA Refseq: NM_004089.4
• Protein Refseq: NP_004080.2
• MIM: 300506
• UniProt ID: Q99576