Recombinant Full Length Human TRIM32 Protein, C-Flag-tagged
Cat.No. : | TRIM32-839HFL |
Product Overview : | Recombinant Full Length Human TRIM32 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71.8 kDa |
AA Sequence : | MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL LVLDCWDHCIKIYSYHLRRYSTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | TRIM32 tripartite motif containing 32 [ Homo sapiens (human) ] |
Official Symbol | TRIM32 |
Synonyms | HT2A; BBS11; TATIP; LGMD2H; LGMDR8 |
Gene ID | 22954 |
mRNA Refseq | NM_012210.4 |
Protein Refseq | NP_036342.2 |
MIM | 602290 |
UniProt ID | Q13049 |
◆ Recombinant Proteins | ||
UBD-28355TH | Recombinant Human UBD, His-tagged | +Inquiry |
CLEC3A-1465H | Recombinant Human CLEC3A Protein, GST-tagged | +Inquiry |
JAK2-2487H | Recombinant human Jak2, His-tagged | +Inquiry |
RFL20137PF | Recombinant Full Length Proteus Mirabilis Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged | +Inquiry |
NPSNL-11622Z | Recombinant Zebrafish NPSNL | +Inquiry |
◆ Native Proteins | ||
TSH-1315B | Active Native Bovine TSH Protein | +Inquiry |
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHNAK-8963HCL | Recombinant Human AHNAK 293 Cell Lysate | +Inquiry |
Heart-97M | Mouse Heart Tissue Lysate (7 day old mouse) | +Inquiry |
OCIAD2-3604HCL | Recombinant Human OCIAD2 293 Cell Lysate | +Inquiry |
OS9-3545HCL | Recombinant Human OS9 293 Cell Lysate | +Inquiry |
ZNF559-2053HCL | Recombinant Human ZNF559 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM32 Products
Required fields are marked with *
My Review for All TRIM32 Products
Required fields are marked with *
0
Inquiry Basket