Recombinant Full Length Human TRIM32 Protein, C-Flag-tagged
Cat.No. : | TRIM32-839HFL |
Product Overview : | Recombinant Full Length Human TRIM32 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71.8 kDa |
AA Sequence : | MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL LVLDCWDHCIKIYSYHLRRYSTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Ubiquitin mediated proteolysis |
Full Length : | Full L. |
Gene Name | TRIM32 tripartite motif containing 32 [ Homo sapiens (human) ] |
Official Symbol | TRIM32 |
Synonyms | HT2A; BBS11; TATIP; LGMD2H; LGMDR8 |
Gene ID | 22954 |
mRNA Refseq | NM_012210.4 |
Protein Refseq | NP_036342.2 |
MIM | 602290 |
UniProt ID | Q13049 |
◆ Recombinant Proteins | ||
TRIM32-839HFL | Recombinant Full Length Human TRIM32 Protein, C-Flag-tagged | +Inquiry |
TRIM32-2257H | Recombinant Human TRIM32 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM32-6330Z | Recombinant Zebrafish TRIM32 | +Inquiry |
Trim32-6653M | Recombinant Mouse Trim32 Protein, Myc/DDK-tagged | +Inquiry |
TRIM32-4773H | Recombinant Human TRIM32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM32-782HCL | Recombinant Human TRIM32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM32 Products
Required fields are marked with *
My Review for All TRIM32 Products
Required fields are marked with *
0
Inquiry Basket