Recombinant Full Length Human TRIM26 Protein, C-Flag-tagged
Cat.No. : | TRIM26-2099HFL |
Product Overview : | Recombinant Full Length Human TRIM26 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Although the function of the protein is unknown, the RING domain suggests that the protein may have DNA-binding activity. The gene localizes to the major histocompatibility complex (MHC) class I region on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62 kDa |
AA Sequence : | MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPFKKENIRPVWQ LASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVMCRESREHRPHTAVLMEK AAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQL AKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVK KKTGEFSDKLLSLQRGLREFQGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQ FDCEPGVLGSKGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG DEEEEEEEEEEEVLESCMVGVARDSVKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAELFPALRPRRVG IALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | TRIM26 tripartite motif containing 26 [ Homo sapiens (human) ] |
Official Symbol | TRIM26 |
Synonyms | AFP; RNF95; ZNF173 |
Gene ID | 7726 |
mRNA Refseq | NM_003449.5 |
Protein Refseq | NP_003440.1 |
MIM | 600830 |
UniProt ID | Q12899 |
◆ Recombinant Proteins | ||
TRIM26-2099HFL | Recombinant Full Length Human TRIM26 Protein, C-Flag-tagged | +Inquiry |
Trim26-6648M | Recombinant Mouse Trim26 Protein, Myc/DDK-tagged | +Inquiry |
TRIM26-4772R | Recombinant Rhesus Macaque TRIM26 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM26-5931R | Recombinant Rat TRIM26 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM26-2254H | Recombinant Human TRIM26 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM26-787HCL | Recombinant Human TRIM26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM26 Products
Required fields are marked with *
My Review for All TRIM26 Products
Required fields are marked with *
0
Inquiry Basket