Recombinant Full Length Human Transmembrane Protein 8B(Tmem8B) Protein, His-Tagged
Cat.No. : | RFL24819HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 8B(TMEM8B) Protein (A6NDV4) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL GSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATA WTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS VGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM8B |
Synonyms | TMEM8B; C9orf127; NGX6; Transmembrane protein 8B; Nasopharyngeal carcinoma-associated gene 6 protein; Protein NAG-5; Protein NGX6 |
UniProt ID | A6NDV4 |
◆ Recombinant Proteins | ||
MATN1-9587M | Recombinant Mouse MATN1 Protein | +Inquiry |
ANKRD23-1413HF | Recombinant Full Length Human ANKRD23 Protein, GST-tagged | +Inquiry |
APEX2-1035HFL | Recombinant Full Length Human APEX2 Protein, C-Flag-tagged | +Inquiry |
COL27A1-1859M | Recombinant Mouse COL27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Car4-662M | Active Recombinant Mouse Car4 protein(Met1-Ser277), His-tagged | +Inquiry |
◆ Native Proteins | ||
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
KLK3-387H | Native Human Prostate Specific Antigen (PSA), Low pI Isoform (IEF) | +Inquiry |
AEBP1-8321S | Native S. cerevisiae AEBP1 | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFB7-3903HCL | Recombinant Human NDUFB7 293 Cell Lysate | +Inquiry |
ROBO1-2256HCL | Recombinant Human ROBO1 293 Cell Lysate | +Inquiry |
C2orf34-8081HCL | Recombinant Human C2orf34 293 Cell Lysate | +Inquiry |
GALR2-6028HCL | Recombinant Human GALR2 293 Cell Lysate | +Inquiry |
MERTK-1816MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM8B Products
Required fields are marked with *
My Review for All TMEM8B Products
Required fields are marked with *
0
Inquiry Basket