Recombinant Full Length Human TMEM8B Protein, GST-tagged

• Cat.No.: TMEM8B-3546HF
• Product Overview: Human C9orf127 full-length ORF (AAH41377.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 257 amino acids
• Description: TMEM8B (Transmembrane Protein 8B) is a Protein Coding gene. Diseases associated with TMEM8B include Nasopharyngeal Carcinoma and Pharynx Cancer. An important paralog of this gene is TMEM8A.
• Molecular Mass: 54.7 kDa
• AA Sequence: MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TMEM8B transmembrane protein 8B [ Homo sapiens ]
• Official Symbol: TMEM8B
• Synonyms: TMEM8B; transmembrane protein 8B; C9orf127, chromosome 9 open reading frame 127; NAG 5; nasopharyngeal carcinoma expressed 6; NGX6; Protein NGX6; protein NAG-5; nasopharyngeal carcinoma related protein; nasopharyngeal carcinoma-associated gene 6 protein; NAG-5; C9orf127; RP11-112J3.10; MGC120460
• Gene ID: 51754
• mRNA Refseq: NM_001042589
• Protein Refseq: NP_001036054
• MIM: 616888
• UniProt ID: A6NDV4