Recombinant Full Length Human Transmembrane Protein 43(Tmem43) Protein, His-Tagged
Cat.No. : | RFL18823HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 43(TMEM43) Protein (Q9BTV4) (2-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-400) |
Form : | Lyophilized powder |
AA Sequence : | AANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKTA TSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMAT APFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRV SFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHREL RSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM43 |
Synonyms | TMEM43; UNQ2564/PRO6244; Transmembrane protein 43; Protein LUMA |
UniProt ID | Q9BTV4 |
◆ Recombinant Proteins | ||
RFL25935SF | Recombinant Full Length Salmonella Paratyphi C Electron Transport Complex Protein Rnfe(Rnfe) Protein, His-Tagged | +Inquiry |
KIF11-2739H | Recombinant Human KIF11 protein, His-tagged | +Inquiry |
DBF4-7188Z | Recombinant Zebrafish DBF4 | +Inquiry |
LRRTM2-1019H | Recombinant Human LRRTM2 | +Inquiry |
VAMP8-30990TH | Recombinant Human VAMP8, His-tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
TG-8265H | Native Human Thyroids Thyroglobulin | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
Streptavidin-24 | Streptavidin | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
THUMPD2-1084HCL | Recombinant Human THUMPD2 293 Cell Lysate | +Inquiry |
DHX32-6930HCL | Recombinant Human DHX32 293 Cell Lysate | +Inquiry |
KCNK10-646HCL | Recombinant Human KCNK10 Lysate | +Inquiry |
NDRG2-3929HCL | Recombinant Human NDRG2 293 Cell Lysate | +Inquiry |
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM43 Products
Required fields are marked with *
My Review for All TMEM43 Products
Required fields are marked with *
0
Inquiry Basket