Recombinant Full Length Rat Transmembrane Protein 43(Tmem43) Protein, His-Tagged
Cat.No. : | RFL27862RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein 43(Tmem43) Protein (Q5XIP9) (2-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-400) |
Form : | Lyophilized powder |
AA Sequence : | AANYSSTGSRKEHVKVTSDPQPGFLERLSETSGGMFVGLVTFLLSFYLIFTNEGRALKTA NLLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESNEYTEDGQVKKETKYSYNTEWRSEIVSSKNFDREIGHKNPSAMAVESFTAT APFVQIGRFFLSAGLIDKIDNFKPLSLAKLEDPHVDIIRRGDFFYHSENPKYPEVGDVRV SFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSGDTLLLLHHGDFSAEEVFRREQ KSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWAALLGCLALVPIIIARTRVPTKKLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem43 |
Synonyms | Tmem43; Transmembrane protein 43; Protein LUMA |
UniProt ID | Q5XIP9 |
◆ Recombinant Proteins | ||
RFL15386EF | Recombinant Full Length Escherichia Coli Upf0756 Membrane Protein Yeal(Yeal) Protein, His-Tagged | +Inquiry |
Osm-10606M | Recombinant Mouse Osm Protein, His (Fc)-Avi-tagged | +Inquiry |
Dacg4-678O | Recombinant Orchard grass Dacg4 protein, His-tagged | +Inquiry |
FHIT-5270H | Recombinant Human FHIT protein, His-tagged | +Inquiry |
Dpm3-2639M | Recombinant Mouse Dpm3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
TIMP1-91B | Active Native Bovine Thrombin | +Inquiry |
LDL-12H | Native Human LDL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SmallIntestine-545E | Equine Small Intestine Lysate, Total Protein | +Inquiry |
ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
SPRED1-1498HCL | Recombinant Human SPRED1 293 Cell Lysate | +Inquiry |
LRG1-755HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
PSMB1-2775HCL | Recombinant Human PSMB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Tmem43 Products
Required fields are marked with *
My Review for All Tmem43 Products
Required fields are marked with *
0
Inquiry Basket