Recombinant Full Length Human Transient Receptor Potential Cation Channel Subfamily V Member 2(Trpv2) Protein, His-Tagged
Cat.No. : | RFL33564HF |
Product Overview : | Recombinant Full Length Human Transient receptor potential cation channel subfamily V member 2(TRPV2) Protein (Q9Y5S1) (1-764aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-764) |
Form : | Lyophilized powder |
AA Sequence : | MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK LLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSWSIW KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRPV2 |
Synonyms | TRPV2; VRL; Transient receptor potential cation channel subfamily V member 2; TrpV2; Osm-9-like TRP channel 2; OTRPC2; Vanilloid receptor-like protein 1; VRL-1 |
UniProt ID | Q9Y5S1 |
◆ Recombinant Proteins | ||
POLQ-3522H | Recombinant Human POLQ protein, His-tagged | +Inquiry |
MS4A5-5639H | Recombinant Human MS4A5 Protein, GST-tagged | +Inquiry |
Arhgef7-1696M | Recombinant Mouse Arhgef7 Protein, Myc/DDK-tagged | +Inquiry |
MEIOC-5045HF | Recombinant Full Length Human MEIOC Protein, GST-tagged | +Inquiry |
TPRG1-4049H | Recombinant Human TPRG1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA7-8269H | Native Human Serum Thyroxine Binding Globulin | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
a-Thrombin-97H | Native Human a-Thrombin | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SENP5-1973HCL | Recombinant Human SENP5 293 Cell Lysate | +Inquiry |
FZD7-6088HCL | Recombinant Human FZD7 293 Cell Lysate | +Inquiry |
CFI-7556HCL | Recombinant Human CFI 293 Cell Lysate | +Inquiry |
MDM4-4403HCL | Recombinant Human MDM4 293 Cell Lysate | +Inquiry |
EPHA3-002MCL | Recombinant Mouse EPHA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRPV2 Products
Required fields are marked with *
My Review for All TRPV2 Products
Required fields are marked with *
0
Inquiry Basket