Recombinant Full Length Human TPRKB Protein, GST-tagged

• Cat.No.: TPRKB-3550HF
• Product Overview: Human TPRKB full-length ORF (NP_057142.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 175 amino acids
• Description: TPRKB (TP53RK Binding Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include protein kinase binding.
• Molecular Mass: 46.1 kDa
• AA Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TPRKB TP53RK binding protein [ Homo sapiens ]
• Official Symbol: TPRKB
• Synonyms: TPRKB; TP53RK binding protein; TP53RK-binding protein; CGI 121; PRPK-binding protein; PRPK (p53-related protein kinase)-binding protein; CGI-121
• Gene ID: 51002
• mRNA Refseq: NM_016058
• Protein Refseq: NP_057142
• MIM: 608680
• UniProt ID: Q9Y3C4