Recombinant Full Length Human TPRKB Protein, GST-tagged

Cat.No. : TPRKB-3550HF
Product Overview : Human TPRKB full-length ORF (NP_057142.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 175 amino acids
Description : TPRKB (TP53RK Binding Protein) is a Protein Coding gene. Among its related pathways are Gene Expression and tRNA processing. GO annotations related to this gene include protein kinase binding.
Molecular Mass : 46.1 kDa
AA Sequence : MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TPRKB TP53RK binding protein [ Homo sapiens ]
Official Symbol TPRKB
Synonyms TPRKB; TP53RK binding protein; TP53RK-binding protein; CGI 121; PRPK-binding protein; PRPK (p53-related protein kinase)-binding protein; CGI-121;
Gene ID 51002
mRNA Refseq NM_016058
Protein Refseq NP_057142
MIM 608680
UniProt ID Q9Y3C4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TPRKB Products

Required fields are marked with *

My Review for All TPRKB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon