Recombinant Full Length Human TKT Protein, C-Flag-tagged
Cat.No. : | TKT-2124HFL |
Product Overview : | Recombinant Full Length Human TKT Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a thiamine-dependent enzyme which plays a role in the channeling of excess sugar phosphates to glycolysis in the pentose phosphate pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.7 kDa |
AA Sequence : | MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDR FVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGK YFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFG WHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS KKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI FKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVG QAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVE DHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Pentose phosphate pathway |
Full Length : | Full L. |
Gene Name | TKT transketolase [ Homo sapiens (human) ] |
Official Symbol | TKT |
Synonyms | TK; TKT1; SDDHD; HEL107; HEL-S-48 |
Gene ID | 7086 |
mRNA Refseq | NM_001064.4 |
Protein Refseq | NP_001055.1 |
MIM | 606781 |
UniProt ID | P29401 |
◆ Recombinant Proteins | ||
TKT-5738R | Recombinant Rat TKT Protein, His (Fc)-Avi-tagged | +Inquiry |
TKT-16809M | Recombinant Mouse TKT Protein | +Inquiry |
TKT-1475D | Recombinant Durum wheat TKT Protein (Ser29-Ser586), N-His tagged | +Inquiry |
TKT-644H | Recombinant Human TKT Protein, His-tagged | +Inquiry |
TKT-4143B | Recombinant Bacillus subtilis TKT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TKT-1054HCL | Recombinant Human TKT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TKT Products
Required fields are marked with *
My Review for All TKT Products
Required fields are marked with *
0
Inquiry Basket