Recombinant Full Length Human TENT5C Protein, C-Flag-tagged
Cat.No. : | TENT5C-901HFL |
Product Overview : | Recombinant Full Length Human TENT5C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Enables RNA adenylyltransferase activity. Involved in mRNA stabilization. Located in cytoplasm and nucleoplasm. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.8 kDa |
AA Sequence : | MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVHDVR LNGSAAGHVLVKDNGLGCKDLDLIFHVALPTEAEFQLVRDVVLCSLLNFLPEGVNKLKISPVTLKEAYVQ KLVKVCTDTDRWSLISLSNKNGKNVELKFVDSIRRQFEFSVDSFQIILDSLLFFYDCSNNPISEHFHPTV IGESMYGDFEEAFDHLQNRLIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFPD ILEQQRKLETYLQNHFAEEERSKYDYLMILRRVVNESTVCLMGHERRQTLNLISLLALRVLAEQNIIPSA TNVTCYYQPAPYVSDGNFSNYYVAHPPVTYSQPYPTWLPCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TENT5C terminal nucleotidyltransferase 5C [ Homo sapiens (human) ] |
Official Symbol | TENT5C |
Synonyms | FAM46C |
Gene ID | 54855 |
mRNA Refseq | NM_017709.4 |
Protein Refseq | NP_060179.2 |
MIM | 613952 |
UniProt ID | Q5VWP2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TENT5C Products
Required fields are marked with *
My Review for All TENT5C Products
Required fields are marked with *
0
Inquiry Basket