Recombinant Full Length Human TCEAL5 Protein, C-Flag-tagged
Cat.No. : | TCEAL5-1887HFL |
Product Overview : | Recombinant Full Length Human TCEAL5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene, which is located on the X chromosome, encodes a protein which contains a BEX (brain expressed X-liked like family) domain. This domain is found in proteins encoded by the TCEAL elongation factor (transcription elongation factor A (SII)-like) gene family also located on the X chromosome. The coding region for this gene is located entirely in the terminal exon. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MEKLYKENEGKPENERNLESEGKPEDEGSTEDEGKSDEEEKPDMEGKTECEGKREDEGEPGDEGQLEDEG NQEKQGKSEGEDKPQSEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDDSPKDSQEDLQERHL SSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQKDLEDVPYV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TCEAL5 transcription elongation factor A like 5 [ Homo sapiens (human) ] |
Official Symbol | TCEAL5 |
Synonyms | WEX4 |
Gene ID | 340543 |
mRNA Refseq | NM_001012979.3 |
Protein Refseq | NP_001012997.1 |
UniProt ID | Q5H9L2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCEAL5 Products
Required fields are marked with *
My Review for All TCEAL5 Products
Required fields are marked with *
0
Inquiry Basket