Recombinant Full Length Human TBCC Protein
Cat.No. : | TBCC-518HF |
Product Overview : | Recombinant full length Human TBCC with N terminal proprietary tag, 64.17 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 346 amino acids |
Description : | Cofactor C is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. |
Form : | Liquid |
Molecular Mass : | 64.170kDa inclusive of tags |
AA Sequence : | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEV ERRKQKRQNQEVEKENSHFFVATFARERAAVEELLERAES VERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARL QAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPP AVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPV STSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDD FNWLARDMASPNWSILPEEERNIQWD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | TBCC tubulin folding cofactor C [ Homo sapiens ] |
Official Symbol | TBCC |
Synonyms | TBCC; tubulin folding cofactor C; tubulin specific chaperone c; tubulin-specific chaperone C; CFC |
Gene ID | 6903 |
mRNA Refseq | NM_003192 |
Protein Refseq | NP_003183 |
MIM | 602971 |
UniProt ID | Q15814 |
◆ Recombinant Proteins | ||
TBCC-518HF | Recombinant Full Length Human TBCC Protein | +Inquiry |
TBCC-9043M | Recombinant Mouse TBCC Protein, His (Fc)-Avi-tagged | +Inquiry |
TBCC-3862H | Recombinant Human TBCC protein, His-tagged | +Inquiry |
Tbcc-6312M | Recombinant Mouse Tbcc Protein, Myc/DDK-tagged | +Inquiry |
TBCC-16505M | Recombinant Mouse TBCC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCC-1218HCL | Recombinant Human TBCC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBCC Products
Required fields are marked with *
My Review for All TBCC Products
Required fields are marked with *
0
Inquiry Basket