Recombinant Full Length Human Sphingosine-1-Phosphate Lyase 1(Sgpl1) Protein, His-Tagged
Cat.No. : | RFL15852HF |
Product Overview : | Recombinant Full Length Human Sphingosine-1-phosphate lyase 1(SGPL1) Protein (O95470) (1-568aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-568) |
Form : | Lyophilized powder |
AA Sequence : | MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SGPL1 |
Synonyms | SGPL1; KIAA1252; Sphingosine-1-phosphate lyase 1; S1PL; SP-lyase 1; SPL 1; hSPL; Sphingosine-1-phosphate aldolase |
UniProt ID | O95470 |
◆ Recombinant Proteins | ||
SGPL1-1297H | Recombinant Human SGPL1 protein, His-tagged | +Inquiry |
SGPL1-8107M | Recombinant Mouse SGPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SGPL1-5577Z | Recombinant Zebrafish SGPL1 | +Inquiry |
Sgpl1-5828M | Recombinant Mouse Sgpl1 Protein, Myc/DDK-tagged | +Inquiry |
SGPL1-5027R | Recombinant Rat SGPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGPL1 Products
Required fields are marked with *
My Review for All SGPL1 Products
Required fields are marked with *
0
Inquiry Basket