Recombinant Full Length Human SOHLH2 Protein, GST-tagged

• Cat.No.: SOHLH2-4888HF
• Product Overview: Human FLJ20449 full-length ORF ( AAH25383, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 13. The proteins encoded by this gene and another testis-specific transcription factor, SOHLH1, can form heterodimers, in addition to homodimers. There is a read-through locus (GeneID: 100526761) that shares sequence identity with this gene and the upstream CCDC169 (GeneID: 728591). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.49 kDa
• Protein length: 225 amino acids
• AA Sequence: MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SOHLH2 spermatogenesis and oogenesis specific basic helix-loop-helix 2 [ Homo sapiens ]
• Official Symbol: SOHLH2
• Synonyms: SOHLH2; spermatogenesis and oogenesis specific basic helix-loop-helix 2; spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2; bHLHe81; FLJ20449; TEB1; FLJ57222
• Gene ID: 54937
• mRNA Refseq: NM_017826
• Protein Refseq: NP_060296
• MIM: 616066
• UniProt ID: Q9NX45