Recombinant Human SOHLH2 protein, GST-tagged

• Cat.No.: SOHLH2-2177H
• Product Overview: Recombinant Human SOHLH2 protein(1-225 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 1-225 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SOHLH2 spermatogenesis and oogenesis specific basic helix-loop-helix 2 [ Homo sapiens ]
• Official Symbol: SOHLH2
• Synonyms: SOHLH2; spermatogenesis and oogenesis specific basic helix-loop-helix 2; spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2; bHLHe81; FLJ20449; TEB1; FLJ57222
• mRNA Refseq: NM_017826
• Protein Refseq: NP_060296
• UniProt ID: Q9NX45
• Gene ID: 54937