Recombinant Full Length Human SMURF2 Protein, C-Flag-tagged
Cat.No. : | SMURF2-980HFL |
Product Overview : | Recombinant Full Length Human SMURF2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables SMAD binding activity; identical protein binding activity; and ubiquitin-protein transferase activity. Involved in negative regulation of transforming growth factor beta receptor signaling pathway; positive regulation of trophoblast cell migration; and ubiquitin-dependent SMAD protein catabolic process. Located in nuclear speck. Part of ubiquitin ligase complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 86 kDa |
AA Sequence : | MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways : | Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, TGF-beta signaling pathway, Type I diabetes mellitus, Ubiquitin mediated proteolysis, Viral myocarditis |
Full Length : | Full L. |
Gene Name | SMURF2 SMAD specific E3 ubiquitin protein ligase 2 [ Homo sapiens (human) ] |
Official Symbol | SMURF2 |
Synonyms | DKFZp686F0270; MGC138150 |
Gene ID | 64750 |
mRNA Refseq | NM_022739.4 |
Protein Refseq | NP_073576.1 |
MIM | 605532 |
UniProt ID | Q9HAU4 |
◆ Recombinant Proteins | ||
SMURF2-5351H | Recombinant Human SMURF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SMURF2-15654M | Recombinant Mouse SMURF2 Protein | +Inquiry |
SMURF2-980HFL | Recombinant Full Length Human SMURF2 Protein, C-Flag-tagged | +Inquiry |
SMURF2-2827H | Recombinant Human SMURF2, His-tagged | +Inquiry |
SMURF2-468H | Recombinant Human SMURF2, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMURF2-1646HCL | Recombinant Human SMURF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMURF2 Products
Required fields are marked with *
My Review for All SMURF2 Products
Required fields are marked with *
0
Inquiry Basket