Recombinant Full Length Human SLC2A5 Protein, C-Flag-tagged
Cat.No. : | SLC2A5-1600HFL |
Product Overview : | Recombinant Full Length Human SLC2A5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a fructose transporter responsible for fructose uptake by the small intestine. The encoded protein also is necessary for the increase in blood pressure due to high dietary fructose consumption. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.8 kDa |
AA Sequence : | MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE LKELPPVTSEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | SLC2A5 solute carrier family 2 member 5 [ Homo sapiens (human) ] |
Official Symbol | SLC2A5 |
Synonyms | GLUT5; GLUT-5 |
Gene ID | 6518 |
mRNA Refseq | NM_003039.3 |
Protein Refseq | NP_003030.1 |
MIM | 138230 |
UniProt ID | P22732 |
◆ Recombinant Proteins | ||
SLC2A5-1600HFL | Recombinant Full Length Human SLC2A5 Protein, C-Flag-tagged | +Inquiry |
SLC2A5-8315M | Recombinant Mouse SLC2A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC2A5-0485H | Recombinant Human SLC2A5 Protein (E2-Q501), 8×His-MBP, Flag tagged | +Inquiry |
SLC2A5-15366M | Recombinant Mouse SLC2A5 Protein | +Inquiry |
SLC2A5-5158R | Recombinant Rat SLC2A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC2A5-1740HCL | Recombinant Human SLC2A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC2A5 Products
Required fields are marked with *
My Review for All SLC2A5 Products
Required fields are marked with *
0
Inquiry Basket