Recombinant Full Length Human SKP2 Protein

• Cat.No.: SKP2-479HF
• Product Overview: Recombinant full length Human SKP2 (amino acids 1-424) with N terminal proprietary tag; Predicted MWt 72.71 kDa including the tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 424 amino acids
• Description: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class; in addition to an F-box, this protein contains 10 tandem leucine-rich repeats. This protein is an essential element of the cyclin A-CDK2 S-phase kinase. It specifically recognizes phosphorylated cyclin-dependent kinase inhibitor 1B (CDKN1B, also referred to as p27 or KIP1) predominantly in S phase and interacts with S-phase kinase-associated protein 1 (SKP1 or p19). In addition, this gene is established as a protooncogene causally involved in the pathogenesis of lymphomas. Alternative splicing of this gene generates three transcript variants encoding different isoforms.
• Form: Liquid
• Molecular Mass: 72.710kDa inclusive of tags
• AA Sequence: MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSA LEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFV IVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGV IAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHG ILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDS VMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPT IGNKKNQEIWGIKCRLTLQKPSCL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SKP2 S-phase kinase-associated protein 2 (p45) [ Homo sapiens ]
• Official Symbol: SKP2
• Synonyms: SKP2; S-phase kinase-associated protein 2 (p45); S-phase kinase-associated protein 2; FBL1; FBXL1
• Gene ID: 6502
• mRNA Refseq: NM_001243120
• Protein Refseq: NP_001230049
• MIM: 601436
• UniProt ID: Q13309