Recombinant Human SKP2 protein, His-SUMO-tagged

Cat.No. : SKP2-4367H
Product Overview : Recombinant Human SKP2 protein(Q13309)(1-424aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His&SUMO
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 63.8 kDa
Protein length : 1-424aa
AA Sequence : MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SKP2 S-phase kinase-associated protein 2, E3 ubiquitin protein ligase [ Homo sapiens ]
Official Symbol SKP2
Synonyms SKP2; S-phase kinase-associated protein 2, E3 ubiquitin protein ligase; S phase kinase associated protein 2 (p45); S-phase kinase-associated protein 2; FBL1; FBXL1; p45; p45skp2; F-box/LRR-repeat protein 1; CDK2/cyclin A-associated protein p45; S-phase kinase-associated protein 2 (p45); FLB1; MGC1366;
Gene ID 6502
mRNA Refseq NM_001243120
Protein Refseq NP_001230049
MIM 601436
UniProt ID Q13309

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SKP2 Products

Required fields are marked with *

My Review for All SKP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon